PDB entry 1bor

View 1bor on RCSB PDB site
Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Deposited on 1995-09-27, released 1997-04-01
The last revision prior to the SCOP 1.57 freeze date was dated 1997-04-01, with a file datestamp of 1997-04-02.
Experiment type: NMR1
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1bor__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bor_ (-)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal