SCOP 1.59: Domain d1rafd2: 1raf D:101-153

Lineage for d1rafd2 (1raf D:101-153)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)

7. Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)

8. Domain d1rafd2: 1raf D:101-153 [45284]
   Other proteins in same PDB: d1rafa1, d1rafa2, d1rafb1, d1rafc1, d1rafc2, d1rafd1

Details for d1rafd2

PDB Entry: 1raf, 2.5 Å

PDB Description: crystal structure of ctp-ligated t state aspartate transcarbamoylase at 2.5 angstroms resolution: implications for atcase mutants and the mechanism of negative cooperativity

SCOP Domain Sequences for d1rafd2:

Sequence; same for both SEQRES and ATOM records:

>d1rafd2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d1rafd2:

• d1rafd2 first appeared (with stable ids) in SCOP 1.55
  
• d1rafd2 appears in SCOP 1.57
  
• d1rafd2 appears in SCOP 1.61
  
• d1rafd2 appears in the current release, SCOPe 2.08