SCOP 1.59: Domain d5at1d2: 5at1 D:101-153

Lineage for d5at1d2 (5at1 D:101-153)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.41: Rubredoxin-like [57769] (9 superfamilies)

4. Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (1 family)

5. Family g.41.7.1: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57826] (1 protein)

6. Protein Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57827] (1 species)

7. Species Escherichia coli [TaxId:562] [57828] (26 PDB entries)

8. Domain d5at1d2: 5at1 D:101-153 [45274]
   Other proteins in same PDB: d5at1a1, d5at1a2, d5at1b1, d5at1c1, d5at1c2, d5at1d1

Details for d5at1d2

PDB Entry: 5at1, 2.6 Å

PDB Description: structural consequences of effector binding to the t state of aspartate carbamoyltransferase. crystal structures of the unligated and atp-, and ctp-complexed enzymes at 2.6-angstroms resolution

SCOP Domain Sequences for d5at1d2:

Sequence; same for both SEQRES and ATOM records:

>d5at1d2 g.41.7.1 (D:101-153) Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain {Escherichia coli}
eridnvlvcpnsncishaepvsssfavrkrandialkckycekefshnvvlan

Timeline for d5at1d2:

• d5at1d2 first appeared (with stable ids) in SCOP 1.55
  
• d5at1d2 appears in SCOP 1.57
  
• d5at1d2 appears in SCOP 1.61
  
• d5at1d2 appears in the current release, SCOPe 2.08