SCOPe 2.01: Domain d1yuaa2: 1yua A:66-122

Lineage for d1yuaa2 (1yua A:66-122)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (5 families)

5. Family g.41.3.3: Prokaryotic DNA topoisomerase I, a C-terminal fragment [57795] (1 protein)
   Duplication: contains tandem repeats of several domains with zinc-binding sites being lost in some of them

6. Protein Prokaryotic DNA topoisomerase I, a C-terminal fragment [57796] (1 species)

7. Species Escherichia coli [TaxId:562] [57797] (1 PDB entry)

8. Domain d1yuaa2: 1yua A:66-122 [45211]
   both domains are zinc-less

Details for d1yuaa2

PDB Entry: 1yua

PDB Description: c-terminal domain of escherichia coli topoisomerase i

PDB Compounds: (A:) topoisomerase I

SCOPe Domain Sequences for d1yuaa2:

Sequence; same for both SEQRES and ATOM records:

>d1yuaa2 g.41.3.3 (A:66-122) Prokaryotic DNA topoisomerase I, a C-terminal fragment {Escherichia coli [TaxId: 562]}
eklryladapqqdpegnktmvrfsrktkqqyvssekdgkatgwsafyvdgkwvegkk

Timeline for d1yuaa2:

• d1yuaa2 first appeared (with stable ids) in SCOP 1.55, called d1yua_2
  
• d1yuaa2 appears in SCOP 1.75
  
• d1yuaa2 appears in SCOPe 2.02
  
• d1yuaa2 appears in the current release, SCOPe 2.08