Lineage for d1qyp__ (1qyp -)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 524121Fold g.41: Rubredoxin-like [57769] (13 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 524176Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) (S)
  5. 524177Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)
  6. 524178Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
    contains two differently decorated domains of this fold
  7. 524179Species Archaeon Thermococcus celer [TaxId:2264] [57788] (1 PDB entry)
  8. 524180Domain d1qyp__: 1qyp - [45205]
    C-terminal domain

Details for d1qyp__

PDB Entry: 1qyp (more details)

PDB Description: thermococcus celer rpb9, nmr, 25 structures

SCOP Domain Sequences for d1qyp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qyp__ g.41.3.1 (-) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer}
gshmeqdlktlpttkitcpkcgndtaywwemqtragdepstifykctkcghtwrsye

SCOP Domain Coordinates for d1qyp__:

Click to download the PDB-style file with coordinates for d1qyp__.
(The format of our PDB-style files is described here.)

Timeline for d1qyp__: