SCOPe 2.05: Domain d1ankb2: 1ank B:122-156

Lineage for d1ankb2 (1ank B:122-156)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families)
   automatically mapped to Pfam PF05191

5. Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)

6. Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)

7. Species Escherichia coli [TaxId:562] [57778] (7 PDB entries)
   contains a rudiment form of the domain that lacks zn-binding site

8. Domain d1ankb2: 1ank B:122-156 [45188]
   Other proteins in same PDB: d1anka1, d1ankb1
   complexed with amp, anp

Details for d1ankb2

PDB Entry: 1ank, 2 Å

PDB Description: the closed conformation of a highly flexible protein: the structure of e. coli adenylate kinase with bound amp and amppnp

PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1ankb2:

Sequence; same for both SEQRES and ATOM records:

>d1ankb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

Timeline for d1ankb2:

• d1ankb2 first appeared (with stable ids) in SCOP 1.55
  
• d1ankb2 appears in SCOPe 2.04
  
• d1ankb2 appears in SCOPe 2.06
  
• d1ankb2 appears in the current release, SCOPe 2.08