Lineage for d1ankb2 (1ank B:122-156)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2262928Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (2 families) (S)
    automatically mapped to Pfam PF05191
  5. 2262929Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 2262930Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (9 species)
  7. 2262954Species Escherichia coli [TaxId:562] [57778] (8 PDB entries)
    contains a rudiment form of the domain that lacks zn-binding site
  8. 2262964Domain d1ankb2: 1ank B:122-156 [45188]
    Other proteins in same PDB: d1anka1, d1ankb1
    complexed with amp, anp

Details for d1ankb2

PDB Entry: 1ank (more details), 2 Å

PDB Description: the closed conformation of a highly flexible protein: the structure of e. coli adenylate kinase with bound amp and amppnp
PDB Compounds: (B:) adenylate kinase

SCOPe Domain Sequences for d1ankb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ankb2 g.41.2.1 (B:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]}
grrvhapsgrvyhvkfnppkvegkddvtgeelttr

SCOPe Domain Coordinates for d1ankb2:

Click to download the PDB-style file with coordinates for d1ankb2.
(The format of our PDB-style files is described here.)

Timeline for d1ankb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ankb1