Class g: Small proteins [56992] (59 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) |
Family g.39.1.2: Nuclear receptor [57721] (8 proteins) |
Protein Estrogen receptor DNA-binding domain [57728] (1 species) |
Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries) |
Domain d1hcqe_: 1hcq E: [45119] |
PDB Entry: 1hcq (more details), 2.4 Å
SCOP Domain Sequences for d1hcqe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcqe_ g.39.1.2 (E:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus)} mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq acrlrkcyevgmmk
Timeline for d1hcqe_: