SCOPe 2.02: Domain d1rxra_: 1rxr A:

Lineage for d1rxra_ (1rxr A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57723] (6 PDB entries)

8. Domain d1rxra_: 1rxr A: [45114]
   complexed with zn

Details for d1rxra_

PDB Entry: 1rxr

PDB Description: high resolution solution structure of the retinoid x receptor dna binding domain, nmr, 20 structure

PDB Compounds: (A:) retinoic acid receptor-alpha

SCOPe Domain Sequences for d1rxra_:

Sequence; same for both SEQRES and ATOM records:

>d1rxra_ g.39.1.2 (A:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ftkhicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqy
cryqkalamgmkreavqeerqrg

Timeline for d1rxra_:

• d1rxra_ first appeared (with stable ids) in SCOP 1.55, called d1rxr__
  
• d1rxra_ appears in SCOPe 2.01
  
• d1rxra_ appears in SCOPe 2.03
  
• d1rxra_ appears in the current release, SCOPe 2.08