Lineage for d3gata_ (3gat A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035588Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
    single zinc-binding motif
  6. 3035589Protein Erythroid transcription factor GATA-1 [57718] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [57719] (4 PDB entries)
  8. 3035591Domain d3gata_: 3gat A: [45103]
    protein/DNA complex; complexed with zn

Details for d3gata_

PDB Entry: 3gat (more details)

PDB Description: solution nmr structure of the c-terminal domain of chicken gata-1 bound to dna, 34 structures
PDB Compounds: (A:) erythroid transcription factor gata-1

SCOPe Domain Sequences for d3gata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]}
kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
kgkkrr

SCOPe Domain Coordinates for d3gata_:

Click to download the PDB-style file with coordinates for d3gata_.
(The format of our PDB-style files is described here.)

Timeline for d3gata_: