Lineage for d1cld__ (1cld -)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523808Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 523809Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 523810Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 523811Protein CD2-Lac9 [57711] (1 species)
  7. 523812Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [57712] (1 PDB entry)
  8. 523813Domain d1cld__: 1cld - [45096]

Details for d1cld__

PDB Entry: 1cld (more details)

PDB Description: dna-binding protein

SCOP Domain Sequences for d1cld__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cld__ g.38.1.1 (-) CD2-Lac9 {Milk yeast (Kluyveromyces lactis)}
qacdacrkkkwkcsktvptctnclkynldcvys

SCOP Domain Coordinates for d1cld__:

Click to download the PDB-style file with coordinates for d1cld__.
(The format of our PDB-style files is described here.)

Timeline for d1cld__: