Lineage for d1pyc__ (1pyc -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144699Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
  4. 144700Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
  5. 144701Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 144716Protein Hap1 (Cyp1) [57709] (1 species)
  7. 144717Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)
  8. 144728Domain d1pyc__: 1pyc - [45095]

Details for d1pyc__

PDB Entry: 1pyc (more details)

PDB Description: cyp1 (hap1) dna-binding domain (residues 60-100), nmr, 15 structures

SCOP Domain Sequences for d1pyc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyc__ g.38.1.1 (-) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
iplscticrkrkvkcdklrphcqqctktgvahlchymeqtw

SCOP Domain Coordinates for d1pyc__:

Click to download the PDB-style file with coordinates for d1pyc__.
(The format of our PDB-style files is described here.)

Timeline for d1pyc__: