SCOP 1.75: Domain d1hwth1: 1hwt H:56-97

Lineage for d1hwth1 (1hwt H:56-97)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Hap1 (Cyp1) [57709] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)

8. Domain d1hwth1: 1hwt H:56-97 [45088]
   Other proteins in same PDB: d1hwtc2, d1hwtd2, d1hwtg2, d1hwth2
   protein/DNA complex; complexed with zn

Details for d1hwth1

PDB Entry: 1hwt, 2.5 Å

PDB Description: structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein

PDB Compounds: (H:) protein (heme activator protein)

SCOP Domain Sequences for d1hwth1:

Sequence; same for both SEQRES and ATOM records:

>d1hwth1 g.38.1.1 (H:56-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krnriplscticrkrkvkcdklrphcqqctktgvahlchyme

Timeline for d1hwth1:

• d1hwth1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwth1 appears in SCOP 1.73
  
• d1hwth1 appears in SCOPe 2.01
  
• d1hwth1 appears in the current release, SCOPe 2.08