Lineage for d1hwth1 (1hwt H:56-97)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035544Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 3035545Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 3035546Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 3035563Protein Hap1 (Cyp1) [57709] (1 species)
  7. 3035564Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)
  8. 3035568Domain d1hwth1: 1hwt H:56-97 [45088]
    Other proteins in same PDB: d1hwtc2, d1hwtd2, d1hwtg2, d1hwth2
    protein/DNA complex; complexed with zn

Details for d1hwth1

PDB Entry: 1hwt (more details), 2.5 Å

PDB Description: structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein
PDB Compounds: (H:) protein (heme activator protein)

SCOPe Domain Sequences for d1hwth1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwth1 g.38.1.1 (H:56-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
krnriplscticrkrkvkcdklrphcqqctktgvahlchyme

SCOPe Domain Coordinates for d1hwth1:

Click to download the PDB-style file with coordinates for d1hwth1.
(The format of our PDB-style files is described here.)

Timeline for d1hwth1: