SCOPe 2.07: Domain d1hwtg1: 1hwt G:59-97

Lineage for d1hwtg1 (1hwt G:59-97)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
   all-alpha dimetal(zinc)-bound fold

4. Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family)
   duplication: two structural repeats are related by the pseudo dyad

5. Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)

6. Protein Hap1 (Cyp1) [57709] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)

8. Domain d1hwtg1: 1hwt G:59-97 [45087]
   Other proteins in same PDB: d1hwtc2, d1hwtd2, d1hwtg2, d1hwth2
   protein/DNA complex; complexed with zn

Details for d1hwtg1

PDB Entry: 1hwt, 2.5 Å

PDB Description: structure of a hap1/dna complex reveals dramatically asymmetric dna binding by a homodimeric protein

PDB Compounds: (G:) protein (heme activator protein)

SCOPe Domain Sequences for d1hwtg1:

Sequence; same for both SEQRES and ATOM records:

>d1hwtg1 g.38.1.1 (G:59-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
riplscticrkrkvkcdklrphcqqctktgvahlchyme

Timeline for d1hwtg1:

• d1hwtg1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwtg1 appears in SCOPe 2.06
  
• d1hwtg1 appears in the current release, SCOPe 2.08