Lineage for d1pyia1 (1pyi A:30-71)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 271076Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 271077Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repears are related by the pseudodyad
  5. 271078Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 271106Protein PPR1 [57705] (1 species)
  7. 271107Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57706] (1 PDB entry)
  8. 271108Domain d1pyia1: 1pyi A:30-71 [45079]
    Other proteins in same PDB: d1pyia2, d1pyib2

Details for d1pyia1

PDB Entry: 1pyi (more details), 3.2 Å

PDB Description: crystal structure of a ppr1-dna complex: dna recognition by proteins containing a zn2cys6 binuclear cluster

SCOP Domain Sequences for d1pyia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyia1 g.38.1.1 (A:30-71) PPR1 {Baker's yeast (Saccharomyces cerevisiae)}
srtackrcrlkkikcdqefpsckrcaklevpcvsldpatgkd

SCOP Domain Coordinates for d1pyia1:

Click to download the PDB-style file with coordinates for d1pyia1.
(The format of our PDB-style files is described here.)

Timeline for d1pyia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pyia2