Lineage for d1aw6a_ (1aw6 A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 892365Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 892366Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 892367Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 892377Protein Gal4 [57703] (1 species)
  7. 892378Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57704] (3 PDB entries)
  8. 892383Domain d1aw6a_: 1aw6 A: [45078]
    complexed with cd

Details for d1aw6a_

PDB Entry: 1aw6 (more details)

PDB Description: gal4 (cd), nmr, 24 structures
PDB Compounds: (A:) gal4 (cd)

SCOP Domain Sequences for d1aw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aw6a_ g.38.1.1 (A:) Gal4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mkllssieqacdicrlkklkcskekpkcakclknnwecryspk

SCOP Domain Coordinates for d1aw6a_:

Click to download the PDB-style file with coordinates for d1aw6a_.
(The format of our PDB-style files is described here.)

Timeline for d1aw6a_: