PDB entry 1aw6

View 1aw6 on RCSB PDB site
Description: gal4 (cd), nmr, 24 structures
Class: transcription regulation
Keywords: transcription regulation, DNA-binding
Deposited on 1997-10-10, released 1998-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 1998-04-15, with a file datestamp of 2007-06-04.
Experiment type: NMR24
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gal4 (cd)
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1aw6a_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1aw6A (A:)
    mkllssieqacdicrlkklkcskekpkcakclknnwecryspk