SCOPe 2.01: Domain d1ubdc3: 1ubd C:351-380

Lineage for d1ubdc3 (1ubd C:351-380)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (7 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)

6. Protein Ying-yang 1 (yy1, zinc finger domain) [57691] (1 species)
   duplication: consists of 4 fingers

7. Species Human (Homo sapiens) [TaxId:9606] [57692] (1 PDB entry)

8. Domain d1ubdc3: 1ubd C:351-380 [45055]
   protein/DNA complex; complexed with zn

Details for d1ubdc3

PDB Entry: 1ubd, 2.5 Å

PDB Description: co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element

PDB Compounds: (C:) protein (yy1 zinc finger domain)

SCOPe Domain Sequences for d1ubdc3:

Sequence; same for both SEQRES and ATOM records:

>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]}
kpfqctfegcgkrfsldfnlrthvrihtgd

Timeline for d1ubdc3:

• d1ubdc3 first appeared (with stable ids) in SCOP 1.55
  
• d1ubdc3 appears in SCOP 1.75
  
• d1ubdc3 appears in SCOPe 2.02
  
• d1ubdc3 appears in the current release, SCOPe 2.08