Lineage for d1ubdc3 (1ubd C:351-380)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144569Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
  4. 144570Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) (S)
  5. 144571Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins)
  6. 144637Protein Ying-yang 1 (yy1, zinc finger domain) [57691] (1 species)
  7. 144638Species Human (Homo sapiens) [TaxId:9606] [57692] (1 PDB entry)
  8. 144641Domain d1ubdc3: 1ubd C:351-380 [45055]

Details for d1ubdc3

PDB Entry: 1ubd (more details), 2.5 Å

PDB Description: co-crystal structure of human yy1 zinc finger domain bound to the adeno-associated virus p5 initiator element

SCOP Domain Sequences for d1ubdc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens)}
kpfqctfegcgkrfsldfnlrthvrihtgd

SCOP Domain Coordinates for d1ubdc3:

Click to download the PDB-style file with coordinates for d1ubdc3.
(The format of our PDB-style files is described here.)

Timeline for d1ubdc3: