SCOPe 2.02: Domain d3znfa_: 3znf A:

Lineage for d3znfa_ (3znf A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Enhancer binding protein [57685] (1 species)
   duplication: consists of two Zn fingers

7. Species Human (Homo sapiens) [TaxId:9606] [57686] (3 PDB entries)

8. Domain d3znfa_: 3znf A: [45049]
   Single zinc finger
   complexed with zn

Details for d3znfa_

PDB Entry: 3znf

PDB Description: high-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution

PDB Compounds: (A:) zinc finger

SCOPe Domain Sequences for d3znfa_:

Sequence; same for both SEQRES and ATOM records:

>d3znfa_ g.37.1.1 (A:) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]}
rpyhcsycnfsfktkgnltkhmkskahskk

Timeline for d3znfa_:

• d3znfa_ first appeared (with stable ids) in SCOP 1.55, called d3znf__
  
• d3znfa_ appears in SCOPe 2.01
  
• d3znfa_ appears in SCOPe 2.03
  
• d3znfa_ appears in the current release, SCOPe 2.08