| Class g: Small proteins [56992] (59 folds) |
| Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily) |
Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (2 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (14 proteins) |
| Protein Enhancer binding protein [57685] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57686] (3 PDB entries) |
| Domain d3znf__: 3znf - [45049] |
PDB Entry: 3znf (more details)
SCOP Domain Sequences for d3znf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3znf__ g.37.1.1 (-) Enhancer binding protein {Human (Homo sapiens)}
rpyhcsycnfsfktkgnltkhmkskahskk
Timeline for d3znf__: