![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
![]() | Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
![]() | Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
![]() | Protein V(D)J recombination activating protein 1 (RAG1), dimerization domain [57671] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57672] (1 PDB entry) |
![]() | Domain d1rmda1: 1rmd A:87-116 [45025] Other proteins in same PDB: d1rmda2 complexed with zn |
PDB Entry: 1rmd (more details), 2.1 Å
SCOPe Domain Sequences for d1rmda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rmda1 g.37.1.1 (A:87-116) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} lmvkcpaqdcneevslekynhhvsshkesk
Timeline for d1rmda1: