PDB entry 1rmd

View 1rmd on RCSB PDB site
Description: rag1 dimerization domain
Class: DNA-binding protein
Keywords: rag1, v(d)j recombination, antibody, mad, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein
Deposited on 1997-01-10, released 1997-07-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rag1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P15919 (0-115)
  Domains in SCOPe 2.03: d1rmda1, d1rmda2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rmdA (A:)
  ncskihlstkllavdfpahfvksiscqicehiladpvetsckhlfcricilrclkvmgsy
  cpscrypcfptdlespvksflnilnslmvkcpaqdcneevslekynhhvsshkesk