| Class g: Small proteins [56992] (72 folds) |
| Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) ![]() |
| Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
| Protein HIPIP (high potential iron protein) [57654] (7 species) |
| Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries) |
| Domain d1pih__: 1pih - [44994] complexed with fs4; mutant |
PDB Entry: 1pih (more details)
SCOP Domain Sequences for d1pih__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pih__ g.35.1.1 (-) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
asepraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlv
kaegwcsvyapas
Timeline for d1pih__: