Lineage for d1pih__ (1pih -)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343805Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 343806Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 343807Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 343808Protein HIPIP (high potential iron protein) [57654] (7 species)
  7. 343826Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries)
  8. 343830Domain d1pih__: 1pih - [44994]
    complexed with fs4; mutant

Details for d1pih__

PDB Entry: 1pih (more details)

PDB Description: the three dimensional structure of the paramagnetic protein hipip i from e.halophila through nuclear magnetic resonance

SCOP Domain Sequences for d1pih__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pih__ g.35.1.1 (-) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
asepraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlv
kaegwcsvyapas

SCOP Domain Coordinates for d1pih__:

Click to download the PDB-style file with coordinates for d1pih__.
(The format of our PDB-style files is described here.)

Timeline for d1pih__: