Lineage for d1pih__ (1pih -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144530Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 144531Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 144532Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 144533Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 144551Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries)
  8. 144555Domain d1pih__: 1pih - [44994]

Details for d1pih__

PDB Entry: 1pih (more details)

PDB Description: the three dimensional structure of the paramagnetic protein hipip i from e.halophila through nuclear magnetic resonance

SCOP Domain Sequences for d1pih__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pih__ g.35.1.1 (-) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
asepraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlv
kaegwcsvyapas

SCOP Domain Coordinates for d1pih__:

Click to download the PDB-style file with coordinates for d1pih__.
(The format of our PDB-style files is described here.)

Timeline for d1pih__: