Lineage for d2hipb_ (2hip B:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429676Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 429677Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 429678Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 429679Protein HIPIP (high potential iron protein) [57654] (7 species)
  7. 429697Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries)
  8. 429699Domain d2hipb_: 2hip B: [44992]
    complexed with fs4

Details for d2hipb_

PDB Entry: 2hip (more details), 2.5 Å

PDB Description: the molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution

SCOP Domain Sequences for d2hipb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hipb_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
egwcsvyapas

SCOP Domain Coordinates for d2hipb_:

Click to download the PDB-style file with coordinates for d2hipb_.
(The format of our PDB-style files is described here.)

Timeline for d2hipb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hipa_