SCOP 1.67: Domain d2hipb_: 2hip B:

Lineage for d2hipb_ (2hip B:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (7 species)

7. Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries)

8. Domain d2hipb_: 2hip B: [44992]
   complexed with fs4

Details for d2hipb_

PDB Entry: 2hip, 2.5 Å

PDB Description: the molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution

SCOP Domain Sequences for d2hipb_:

Sequence; same for both SEQRES and ATOM records:

>d2hipb_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
egwcsvyapas

Timeline for d2hipb_:

• d2hipb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hipb_ appears in SCOP 1.65
  
• d2hipb_ appears in SCOP 1.69
  
• d2hipb_ appears in the current release, SCOPe 2.08