Lineage for d2hipb_ (2hip B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) 
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) Protein HIPIP (high potential iron protein) [57654] (6 species) 
Species Ectothiorhodospira halophila [TaxId:17] [57658] (3 PDB entries) 
Domain d2hipb_: 2hip B: [44992]
Details for d2hipb_
PDB Entry: 2hip (more details), 2.5 Å
PDB Description: the molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution
SCOP Domain Sequences for d2hipb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hipb_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Ectothiorhodospira halophila}
epraedghahdyvneaadasghpryqegqlcencafwgeavqdgwgrcthpdfdevlvka
egwcsvyapas
SCOP Domain Coordinates for d2hipb_:
Click to download the PDB-style file with coordinates for d2hipb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hipb_:
- d2hipb_ appears in SCOP 1.57
- d2hipb_ appears in the current release, SCOPe 2.08
View in 3D
