SCOPe 2.07: Domain d1neha_: 1neh A:

Lineage for d1neha_ (1neh A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)

8. Domain d1neha_: 1neh A: [44986]
   complexed with sf4

Details for d1neha_

PDB Entry: 1neh

PDB Description: high potential iron-sulfur protein

PDB Compounds: (A:) high potential iron sulfur protein

SCOPe Domain Sequences for d1neha_:

Sequence; same for both SEQRES and ATOM records:

>d1neha_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId: 1049]}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

Timeline for d1neha_:

• d1neha_ first appeared (with stable ids) in SCOP 1.55, called d1neh__
  
• d1neha_ appears in SCOPe 2.06
  
• d1neha_ appears in the current release, SCOPe 2.08