SCOP 1.63: Domain d1ckub_: 1cku B:

Lineage for d1ckub_ (1cku B:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (6 species)

7. Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)

8. Domain d1ckub_: 1cku B: [44982]
   complexed with fs4

Details for d1ckub_

PDB Entry: 1cku, 1.2 Å

PDB Description: ab initio solution and refinement of two high potential iron protein structures at atomic resolution

SCOP Domain Sequences for d1ckub_:

Sequence; same for both SEQRES and ATOM records:

>d1ckub_ g.35.1.1 (B:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum)}
sapanavaaddataialkynqdatkservaaarpglppeeqhcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

Timeline for d1ckub_:

• d1ckub_ first appeared (with stable ids) in SCOP 1.55
  
• d1ckub_ appears in SCOP 1.61
  
• d1ckub_ appears in SCOP 1.65
  
• d1ckub_ appears in the current release, SCOPe 2.08