Lineage for d1b0ya_ (1b0y A:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204507Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
  4. 204508Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 204509Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 204510Protein HIPIP (high potential iron protein) [57654] (6 species)
  7. 204511Species Allochromatium vinosum, (formerly Chromatium vinosum) [TaxId:1049] [57656] (8 PDB entries)
  8. 204512Domain d1b0ya_: 1b0y A: [44980]

Details for d1b0ya_

PDB Entry: 1b0y (more details), 0.93 Å

PDB Description: mutant h42q of hipip from chromatium vinosum at 0.93a

SCOP Domain Sequences for d1b0ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ya_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Allochromatium vinosum, (formerly Chromatium vinosum)}
sapanavaadnataialkynqdatkservaaarpglppeeqqcancqfmqadaagatdew
kgcqlfpgklinvngwcaswtlkag

SCOP Domain Coordinates for d1b0ya_:

Click to download the PDB-style file with coordinates for d1b0ya_.
(The format of our PDB-style files is described here.)

Timeline for d1b0ya_: