SCOP 1.67: Domain d2pf2_2: 2pf2 1-65

Lineage for d2pf2_2 (2pf2 1-65)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.32: GLA-domain [57629] (1 superfamily)
   Calcium ion-bound

4. Superfamily g.32.1: GLA-domain [57630] (1 family)
   gamma-carboxy-glutamic acid-rich domain

5. Family g.32.1.1: GLA-domain [57631] (6 proteins)

6. Protein Prothrombin [57634] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57635] (5 PDB entries)

8. Domain d2pf2_2: 2pf2 1-65 [44967]
   Other proteins in same PDB: d2pf2_1
   complexed with ca

Details for d2pf2_2

PDB Entry: 2pf2, 2.2 Å

PDB Description: the ca+2 ion and membrane binding structure of the gla domain of ca- prothrombin fragment 1

SCOP Domain Sequences for d2pf2_2:

Sequence, based on SEQRES records:

>d2pf2_2 g.32.1.1 (1-65) Prothrombin {Cow (Bos taurus)}
ankgfleevrkgnlreecleepcsreeafealeslsatdafwakytacesarnpreklne
clegn

Sequence, based on observed residues (ATOM records):

>d2pf2_2 g.32.1.1 (1-65) Prothrombin {Cow (Bos taurus)}
ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
clegn

Timeline for d2pf2_2:

• d2pf2_2 first appeared (with stable ids) in SCOP 1.55
  
• d2pf2_2 appears in SCOP 1.65
  
• d2pf2_2 appears in SCOP 1.69
  
• d2pf2_2 appears in the current release, SCOPe 2.08, called d2pf2a2