Lineage for d2pf2_2 (2pf2 1-65)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 523544Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 523545Superfamily g.32.1: GLA-domain [57630] (1 family) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 523546Family g.32.1.1: GLA-domain [57631] (6 proteins)
  6. 523577Protein Prothrombin [57634] (1 species)
  7. 523578Species Cow (Bos taurus) [TaxId:9913] [57635] (5 PDB entries)
  8. 523580Domain d2pf2_2: 2pf2 1-65 [44967]
    Other proteins in same PDB: d2pf2_1

Details for d2pf2_2

PDB Entry: 2pf2 (more details), 2.2 Å

PDB Description: the ca+2 ion and membrane binding structure of the gla domain of ca- prothrombin fragment 1

SCOP Domain Sequences for d2pf2_2:

Sequence, based on SEQRES records: (download)

>d2pf2_2 g.32.1.1 (1-65) Prothrombin {Cow (Bos taurus)}
ankgfleevrkgnlreecleepcsreeafealeslsatdafwakytacesarnpreklne
clegn

Sequence, based on observed residues (ATOM records): (download)

>d2pf2_2 g.32.1.1 (1-65) Prothrombin {Cow (Bos taurus)}
ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
clegn

SCOP Domain Coordinates for d2pf2_2:

Click to download the PDB-style file with coordinates for d2pf2_2.
(The format of our PDB-style files is described here.)

Timeline for d2pf2_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf2_1