Lineage for d1dqca_ (1dqc A:)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1243714Fold g.31: Invertebrate chitin-binding proteins [57624] (1 superfamily)
    disulfide-rich
  4. 1243715Superfamily g.31.1: Invertebrate chitin-binding proteins [57625] (2 families) (S)
    shares a putative chitin-binding motif with the plant lectins/antimicrobial peptides superfamily but lacks one of the conserved disulfides of the knottin fold
  5. 1243716Family g.31.1.1: Tachycitin [57626] (1 protein)
  6. 1243717Protein Tachycitin [57627] (1 species)
    an antimicrobial protein with chitin-binding function
  7. 1243718Species Horseshoe crab (Tachypleus tridentatus) [TaxId:6853] [57628] (1 PDB entry)
  8. 1243719Domain d1dqca_: 1dqc A: [44964]

Details for d1dqca_

PDB Entry: 1dqc (more details)

PDB Description: solution structure of tachycitin, an antimicrobial protein with chitin-binding function
PDB Compounds: (A:) tachycitin

SCOPe Domain Sequences for d1dqca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]}
ylafrcgryspclddgpnvnlysccsfynchkclarlencpkglhynaylkvcdwpskag
ctsvnkechlwkt

SCOPe Domain Coordinates for d1dqca_:

Click to download the PDB-style file with coordinates for d1dqca_.
(The format of our PDB-style files is described here.)

Timeline for d1dqca_: