Lineage for d1tpna_ (1tpn A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462729Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1462730Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1462731Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
    automatically mapped to Pfam PF00039
  6. 1462781Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)
  7. 1462782Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)
  8. 1462783Domain d1tpna_: 1tpn A: [44956]

Details for d1tpna_

PDB Entry: 1tpn (more details)

PDB Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance
PDB Compounds: (A:) tissue-type plasminogen activator

SCOPe Domain Sequences for d1tpna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpna_ g.27.1.1 (A:) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens) [TaxId: 9606]}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

SCOPe Domain Coordinates for d1tpna_:

Click to download the PDB-style file with coordinates for d1tpna_.
(The format of our PDB-style files is described here.)

Timeline for d1tpna_: