SCOP 1.63: Domain d1qo6a2: 1qo6 A:1-41

Lineage for d1qo6a2 (1qo6 A:1-41)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)
   disulphide-rich, all-beta

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)

8. Domain d1qo6a2: 1qo6 A:1-41 [44954]
   Other proteins in same PDB: d1qo6a1
   part of the gelatin-binding domain

Details for d1qo6a2

PDB Entry: 1qo6

PDB Description: solution structure of a pair of modules from the gelatin-binding domain of fibronectin

SCOP Domain Sequences for d1qo6a2:

Sequence; same for both SEQRES and ATOM records:

>d1qo6a2 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens)}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

Timeline for d1qo6a2:

• d1qo6a2 first appeared (with stable ids) in SCOP 1.55
  
• d1qo6a2 appears in SCOP 1.61
  
• d1qo6a2 appears in SCOP 1.65
  
• d1qo6a2 appears in the current release, SCOPe 2.08