Lineage for d1qgba1 (1qgb A:17-60)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204423Fold g.27: Fibronectin type I module [57602] (1 superfamily)
  4. 204424Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 204425Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 204426Protein Fibronectin [57605] (1 species)
  7. 204427Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)
  8. 204433Domain d1qgba1: 1qgb A:17-60 [44952]

Details for d1qgba1

PDB Entry: 1qgb (more details)

PDB Description: solution structure of the n-terminal f1 module pair from human fibronectin

SCOP Domain Sequences for d1qgba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgba1 g.27.1.1 (A:17-60) Fibronectin {Human (Homo sapiens)}
skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskp

SCOP Domain Coordinates for d1qgba1:

Click to download the PDB-style file with coordinates for d1qgba1.
(The format of our PDB-style files is described here.)

Timeline for d1qgba1:

204433
d1qgba1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qgba2