Class g: Small proteins [56992] (94 folds) |
Fold g.26: Antifungal protein (AGAFP) [57597] (1 superfamily) disulfide-rich; all-beta: open barrel, 5 strands; OB-fold-like |
Superfamily g.26.1: Antifungal protein (AGAFP) [57598] (1 family) automatically mapped to Pfam PF11402 |
Family g.26.1.1: Antifungal protein (AGAFP) [57599] (1 protein) |
Protein Antifungal protein (AGAFP) [57600] (1 species) |
Species Fungus (Aspergillus giganteus) [TaxId:5060] [57601] (1 PDB entry) |
Domain d1afpa_: 1afp A: [44947] |
PDB Entry: 1afp (more details)
SCOPe Domain Sequences for d1afpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afpa_ g.26.1.1 (A:) Antifungal protein (AGAFP) {Fungus (Aspergillus giganteus) [TaxId: 5060]} atyngkcykkdnickykaqsgktaickcyvkkcprdgakcefdsykgkcyc
Timeline for d1afpa_: