Lineage for d1du3g2 (1du3 G:62-101)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639383Protein Death receptor-5 (dr5) fragment [57590] (1 species)
  7. 2639384Species Human (Homo sapiens) [TaxId:9606] [57591] (5 PDB entries)
  8. 2639411Domain d1du3g2: 1du3 G:62-101 [44937]
    Other proteins in same PDB: d1du3d_, d1du3e_, d1du3f_, d1du3j_, d1du3k_, d1du3l_
    complexed with zn

Details for d1du3g2

PDB Entry: 1du3 (more details), 2.2 Å

PDB Description: crystal structure of trail-sdr5
PDB Compounds: (G:) death receptor 5

SCOPe Domain Sequences for d1du3g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du3g2 g.24.1.1 (G:62-101) Death receptor-5 (dr5) fragment {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOPe Domain Coordinates for d1du3g2:

Click to download the PDB-style file with coordinates for d1du3g2.
(The format of our PDB-style files is described here.)

Timeline for d1du3g2: