Class g: Small proteins [56992] (79 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (2 families) |
Family g.24.1.1: TNF receptor-like [57587] (4 proteins) Pfam 00020; TNFR/NGFR cysteine-rich region |
Protein Tumor necrosis factor (TNF) receptor [57588] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries) |
Domain d1tnrr2: 1tnr R:72-115 [44913] Other proteins in same PDB: d1tnra_ |
PDB Entry: 1tnr (more details), 2.85 Å
SCOP Domain Sequences for d1tnrr2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tnrr2 g.24.1.1 (R:72-115) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens)} scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf
Timeline for d1tnrr2: