Lineage for d1tnrr2 (1tnr R:72-115)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749631Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 749632Superfamily g.24.1: TNF receptor-like [57586] (2 families) (S)
  5. 749633Family g.24.1.1: TNF receptor-like [57587] (5 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 749689Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 749690Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 749704Domain d1tnrr2: 1tnr R:72-115 [44913]
    Other proteins in same PDB: d1tnra_

Details for d1tnrr2

PDB Entry: 1tnr (more details), 2.85 Å

PDB Description: crystal structure of the soluble human 55 kd tnf receptor-human tnf- beta complex: implications for tnf receptor activation
PDB Compounds: (R:) tumor necrosis factor receptor p55

SCOP Domain Sequences for d1tnrr2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnrr2 g.24.1.1 (R:72-115) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf

SCOP Domain Coordinates for d1tnrr2:

Click to download the PDB-style file with coordinates for d1tnrr2.
(The format of our PDB-style files is described here.)

Timeline for d1tnrr2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tnra_