Lineage for d1ncfa1 (1ncf A:11-71)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144375Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 144376Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 144377Family g.24.1.1: TNF receptor-like [57587] (3 proteins)
  6. 144414Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 144415Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 144422Domain d1ncfa1: 1ncf A:11-71 [44906]

Details for d1ncfa1

PDB Entry: 1ncf (more details), 2.25 Å

PDB Description: a new paradigm for tumor necrosis factor signalling

SCOP Domain Sequences for d1ncfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncfa1 g.24.1.1 (A:11-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens)}
mdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhc
l

SCOP Domain Coordinates for d1ncfa1:

Click to download the PDB-style file with coordinates for d1ncfa1.
(The format of our PDB-style files is described here.)

Timeline for d1ncfa1: