Lineage for d1mdam_ (1mda M:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1964111Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1964112Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1964113Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1964114Protein Methylamine dehydrogenase [57563] (2 species)
  7. 1964115Species Paracoccus denitrificans [TaxId:266] [57564] (7 PDB entries)
  8. 1964131Domain d1mdam_: 1mda M: [44886]
    Other proteins in same PDB: d1mdaa_, d1mdab_, d1mdah_, d1mdaj_
    complexed with cu

Details for d1mdam_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (M:) methylamine dehydrogenase (light subunit)

SCOPe Domain Sequences for d1mdam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdam_ g.21.1.1 (M:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
vdprakwqpqdndiqacdywrhcsiagnicdcsagsltscppgtlvasgswvgscynppd
pnkyitayrdccgynvsgrcaclntegelpvynkdandiiwcfggedgmtyhcsispvsg
a

SCOPe Domain Coordinates for d1mdam_:

Click to download the PDB-style file with coordinates for d1mdam_.
(The format of our PDB-style files is described here.)

Timeline for d1mdam_: