Lineage for d1mdab_ (1mda B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1774126Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1774127Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1774128Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1774129Protein Amicyanin [49505] (2 species)
  7. 1774130Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 1774194Domain d1mdab_: 1mda B: [22845]
    Other proteins in same PDB: d1mdah_, d1mdaj_, d1mdal_, d1mdam_
    complexed with cu

Details for d1mdab_

PDB Entry: 1mda (more details), 2.5 Å

PDB Description: crystal structure of an electron-transfer complex between methylamine dehydrogenase and amicyanin
PDB Compounds: (B:) amicyanin

SCOPe Domain Sequences for d1mdab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdab_ b.6.1.1 (B:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
atipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvagvl
geaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d1mdab_:

Click to download the PDB-style file with coordinates for d1mdab_.
(The format of our PDB-style files is described here.)

Timeline for d1mdab_: