Lineage for d1sgfb_ (1sgf B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260390Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2260391Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2260595Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 2260596Protein beta-Nerve growth factor [57525] (2 species)
  7. 2260609Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)
  8. 2260614Domain d1sgfb_: 1sgf B: [44805]
    Other proteins in same PDB: d1sgfa_, d1sgfg_, d1sgfx_, d1sgfz_
    complexed with nag, zn

Details for d1sgfb_

PDB Entry: 1sgf (more details), 3.15 Å

PDB Description: crystal structure of 7s ngf: a complex of nerve growth factor with four binding proteins (serine proteinases)
PDB Compounds: (B:) nerve growth factor

SCOPe Domain Sequences for d1sgfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgfb_ g.17.1.3 (B:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr

SCOPe Domain Coordinates for d1sgfb_:

Click to download the PDB-style file with coordinates for d1sgfb_.
(The format of our PDB-style files is described here.)

Timeline for d1sgfb_: