Lineage for d1beta_ (1bet A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963384Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 1963385Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 1963577Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 1963578Protein beta-Nerve growth factor [57525] (2 species)
  7. 1963589Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries)
  8. 1963590Domain d1beta_: 1bet A: [44801]

Details for d1beta_

PDB Entry: 1bet (more details), 2.3 Å

PDB Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor
PDB Compounds: (A:) Beta-nerve growth factor

SCOPe Domain Sequences for d1beta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beta_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka

SCOPe Domain Coordinates for d1beta_:

Click to download the PDB-style file with coordinates for d1beta_.
(The format of our PDB-style files is described here.)

Timeline for d1beta_: