| Class g: Small proteins [56992] (92 folds) |
| Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
| Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
| Protein beta-Nerve growth factor [57525] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries) |
| Domain d1beta_: 1bet A: [44801] |
PDB Entry: 1bet (more details), 2.3 Å
SCOPe Domain Sequences for d1beta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beta_ g.17.1.3 (A:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka
Timeline for d1beta_: