Lineage for d1bet__ (1bet -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.3: Neurotrophin [57520] (3 proteins) 
Protein beta-Nerve growth factor [57525] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries) 
Domain d1bet__: 1bet - [44801]
Details for d1bet__
PDB Entry: 1bet (more details), 2.3 Å
PDB Description: new protein fold revealed by a 2.3 angstrom resolution crystal structure of nerve growth factor
SCOP Domain Sequences for d1bet__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bet__ g.17.1.3 (-) beta-Nerve growth factor {Mouse (Mus musculus)}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrka
SCOP Domain Coordinates for d1bet__:
Click to download the PDB-style file with coordinates for d1bet__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bet__:
- d1bet__ appears in SCOP 1.57
- d1bet__ appears in the current release, SCOPe 2.08, called d1beta_
View in 3D