Lineage for d1posb1 (1pos B:1-53)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260335Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
    disulfide-rich fold; common core is alpha+beta with two conserved disulfides
  4. 2260336Superfamily g.16.1: Trefoil [57492] (1 family) (S)
  5. 2260337Family g.16.1.1: Trefoil [57493] (3 proteins)
  6. 2260343Protein Pancreatic spasmolytic polypeptide [57494] (1 species)
    duplication: consists of two homologous domains
  7. 2260344Species Pig (Sus scrofa) [TaxId:9823] [57495] (4 PDB entries)
  8. 2260355Domain d1posb1: 1pos B:1-53 [44740]
    CA-atoms only

Details for d1posb1

PDB Entry: 1pos (more details), 2.6 Å

PDB Description: crystal structure of a novel disulfide-linked "trefoil" motif found in a large family of putative growth factors
PDB Compounds: (B:) porcine pancreatic spasmolytic polypeptide

SCOPe Domain Sequences for d1posb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1posb1 g.16.1.1 (B:1-53) Pancreatic spasmolytic polypeptide {Pig (Sus scrofa) [TaxId: 9823]}
ekpaacrcsrqdpknrvncgfpgitsdqcftsgccfdsqvpgvpwcfkplpaq

SCOPe Domain Coordinates for d1posb1:

Click to download the PDB-style file with coordinates for d1posb1.
(The format of our PDB-style files is described here.)

Timeline for d1posb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1posb2