| Class g: Small proteins [56992] (100 folds) |
| Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
| Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
| Protein Domain of BM-40/SPARC/osteonectin [57478] (1 species) the C-terminal part of FS module |
| Species Human (Homo sapiens) [TaxId:9606] [57479] (2 PDB entries) |
| Domain d1bmob3: 1bmo B:78-135 [44718] Other proteins in same PDB: d1bmoa1, d1bmoa2, d1bmob1, d1bmob2 complexed with ca |
PDB Entry: 1bmo (more details), 3.1 Å
SCOPe Domain Sequences for d1bmob3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmob3 g.68.1.1 (B:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]}
cqdptscpapigefekvcsndnktfdsschffatkctlegtkkghklhldyigpckyi
Timeline for d1bmob3: